PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01947.1.p
Common NameEUGRSUZ_I01947, LOC104419365
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 517aa    MW: 55757.7 Da    PI: 5.181
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01947.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-39152212262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Eucgr.I01947.1.p 152 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 212
                       7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-31149209IPR003851Zinc finger, Dof-type
PfamPF027014.1E-32154210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975156210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610158194IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MPGEARDPAI KLFGKTISLP DIPPGDAAAA AVDTGQVPSA DPPSPAREDI GMAGVDGGEE  60
EEGDEDEYEE DDDEEGRDDK ETQDEKPAIA KLENGAQFMN LEEGTNRDAI SVTNENPRTP  120
SVDKESTTPR TSKSEEEQSD TSNSQEKVLK KPDKILPCPR CNSMDTKFCY YNNYNVNQPR  180
HFCKNCQRYW TAGGTMRNVP VGAGRRKNKN SASHYRHLAV PEALQSVRTD FPNGVHHPPL  240
KPNGTVLTFG SDAPLCESMA SVLHLADKAM HNSRKNGFHK PEGVIMPSPC GSVRSGVETM  300
NGSSATAANS NLVESKNGTK EIVMPNCQGF PPQLPCFPGA PWPYAWNSAP WSPPISPGPQ  360
TFCPPGFAVP FYAGPAYWSC SVPGAWNIPW VAQPTSPNHS ATSSAPNSPT LGKHSRDEKI  420
GKPNDSTEEE PKEANPERSL WIPKTLRIDD PGEAAKSSIW ATLGIKNEAS NSAGRGVLLK  480
AFQSKSEEKN HVVEASSVLQ ANPAALSRSR NFQESS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01947.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU0308434e-71KU030843.1 Camellia sinensis DNA binding with one finger 2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029305.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A059AQE40.0A0A059AQE4_EUCGR; Uncharacterized protein
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-113cycling DOF factor 2